PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi07g12760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family YABBY
Protein Properties Length: 196aa    MW: 21816.9 Da    PI: 6.7129
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi07g12760.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY54.55.1e-173613223119
            YABBY  23 avsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvi 116
                       vsvP tslfk+vtvrCGhCt+ll vn++      +++ hl++s+  + ++ l+   +      +++ + s+s++ ++  +   +e+pr+p ++
  Vradi07g12760.1  36 QVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLVPSPTQFHLGHSFFSPSHNLLEEIPNPSPNFLMNQANLSASNEFSMPARTAADELPRPPIIN 129
                      69******************************************99986666666666555555666666666665555788899999999899 PP

            YABBY 117 rPP 119
                      r P
  Vradi07g12760.1 130 RRP 132
                      877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046903.9E-143679IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MDDDTVVFFG MRESHRAYMS MDGDGSDRIF RRSMDQVSVP CTSLFKTVTV RCGHCTNLLP  60
VNMRGLLVPS PTQFHLGHSF FSPSHNLLEE IPNPSPNFLM NQANLSASNE FSMPARTAAD  120
ELPRPPIINR RPVPLVEEKG SFKGFIATWA HFPHIHFGLM PDQTVKKTNV CQQEGEEVLM  180
KDGFYASANV GVSPY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150347e-77AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549900.19e-94PREDICTED: protein YABBY 4-like isoform X1
SwissprotO221521e-36YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A0B2PQ629e-94A0A0B2PQ62_GLYSO; Protein YABBY 5
TrEMBLI1MUX59e-94I1MUX5_SOYBN; Uncharacterized protein
STRINGGLYMA17G14710.13e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20403490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.11e-33YABBY family protein